[kepler-users] SOAP Complex type packing

[Kyle Ellrott]

This particular interface is described at http://www.cbs.dtu.dk/ws/ 
ws.php?entry=SignalP
The namespace is described in
http://www.cbs.dtu.dk/ws/SignalP/ws_signalp_3_1.xsd
http://www.cbs.dtu.dk/ws/common/ws_common_1_0.xsd


There is an example python SOAP script
http://www.cbs.dtu.dk/ws/SignalP/examples/signalP.py


The input could be the string as the sequences

 >seq1
ASTPGHTIIYEAVCLHNDRTTIP
 >seq2 optional comment
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES

Parameters:
organism = gram+
method=nn+hmm


In the end, there would also need to be a method to parse the  
fetchResultResponse type


You can see comparable results by running the same sequence the web  
page at http://www.cbs.dtu.dk/services/SignalP/


Kyle




> Hi Kyle,
>
> I'm working on a new web service actor that can send and receive  
> complex data types.
> The SignalP service would be a good test; can you give me some  
> example inputs and
> expected outputs for using 'runService'?
>
> Thanks,
>  --dan
>
> Kyle Ellrott wrote:
>> I'm new to Kepler, so I'm still getting used to how things work.
>> I'm making a small test workflow that takes an amino acid  
>> sequence  and runs it on a SignalP soap server, described at  
>> http:// www.cbs.dtu.dk/ws/SignalP/SignalP_3_1.wsdl
>> The example included with Kepler, 06-  
>> WebServicesAndDataTransformation.xml, the service uses a standard   
>> string as input.  SignalP uses a complex type 'runService'  
>> described  in  http://www.cbs.dtu.dk/ws/SignalP/ws_signalp_3_1.xsd  
>> and http:// www.cbs.dtu.dk/ws//common/ws_common_1_0.xsd
>> Basically I need to take an input string and an id, pack it into  
>> the  complex 'sequences', pack that into a 'runService', with  
>> some  parameters, and then use that as input to the web server actor.
>> Are there some default actors that can take several individual  
>> types  and pack them into a complex type?  Does anybody have any  
>> examples of  how to do this sort of thing?
>>
>> Thanks,
>> Kyle Ellrott
>> _______________________________________________
>> Kepler-users mailing list
>> Kepler-users at ecoinformatics.org
>> http://mercury.nceas.ucsb.edu/ecoinformatics/mailman/listinfo/ 
>> kepler-users
>>
>